Product Overview
Amino Acid Sequence
IKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDN ITHVPGGGNKKIETHKLTFRENAKAKTDHGAE
Tag/Conjugate
Unconjugated
Bio-activity
Thioflavin T emission curves show increased fluorescence (correlated to tau aggregation) over time when truncated tau fragment (AA297-391) (dGAE) monomer is combined with truncated tau fragment (AA297-391) (dGAE) Pre-formed Fibrils.
Alternative Names
Active tau aggregate; tau PFFs; tau PFF; active tau protein aggregate; active tau protein; microtubule-associated protein tau; MAPT; MAP; microtubule-associated protein; Truncated Tau Protein Aggregate; Paired Helical Filament-Tau; Phf-Tau; Neurofibrillary Tangle Protein; G Protein Beta1/Gamma2 Subunit-Interacting Factor 1; Isoform 2; tubulin-associated unit; 95-amino acid tau protein fragment; Truncated Tau Protein
Concentration
Batch dependent - please inquire should you have specific requirements
Introduction
Tau protein is a highly soluble microtubule-associated protein (MAP) that is abundant in neurons of the central nervous system and relatively poorly expressed in non-neuronal cells (astrocytes, oligodendrocytes, etc.). One of its main functions is to maintain axonal microtubule stability and ensure normal brain function. The neurofibrillary tangles observed in Alzheimer's disease (AD) and other tau lesions are aggregations of paired helical fibrils composed of hyperphosphorylated tau.
Keywords
Alzheimer's Disease; Axon Markers; Cell Markers; Cell Signaling; Cytoskeleton; Microtubules; MT Associated Proteins; Neurodegeneration; Neuron Markers; Neuroscience; Tangles & Tau
Citations
Publication ()
Have you cited PFF17 in a publication?
Let us know and earn a reward for your research.