Rabbit Anti-Human FOXO1 Polyclonal Antibody (DPABH-01010)

Rabbit Anti-Human FOXO1 Polyclonal Antibody for IHC Datasheet

Bring this labeled antibody directly to your bench!

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Mouse, Human
Immunogen
Recombinant Protein, antigen sequence: LTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDM
Conjugate
unconjugated

Applications


Application Notes
IHC: 1:20 - 1:50
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunofluorescence staining of mouse visual cortex shows immunoreactivity in a subset of neurons.

Target


Alternative Names
FOXO1; forkhead box O1; FKH1; FKHR; FOXO1A; forkhead box protein O1
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-01010 in a publication? Let us know and earn a reward for your research.

References


Jeon, JH; Suh, HN; et al. Glucosamine-Induced OGT Activation Mediates Glucose Production Through Cleaved Notch1 and FoxO1, Which Coordinately Contributed to the Regulation of Maintenance of Self-Renewal in Mouse Embryonic Stem Cells. STEM CELLS AND DEVELOPMENT 23:2067-2079(2014).
Han, CY; Cho, KB; et al. Role of FoxO1 activation in MDR1 expression in adriamycin-resistant breast cancer cells. CARCINOGENESIS 29:1837-1844(2008).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-Human FOXO1 Polyclonal Antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket