Synthetic peptide within Human RIT1 aa 11-60 (N terminal). The exact sequence is proprietary.Sequence: TMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRD Database link: NP_001102655
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
RIT1; Ras-like without CAAX 1; Ric (Drosophila) like, expressed in many tissues; RIT; GTP-binding protein Rit1; GTP binding protein Roc1; MGC125864; MGC125865; RIBB; Ric like; expressed in many tissues; ROC1; GTP-binding protein Roc1; ras-like without CAA
Plays a crucial role in coupling NGF stimulation to the activation of both EPHB2 and MAPK14 signaling pathways and in NGF-dependent neuronal differentiation.
Pathway
NGF signalling via TRKA from the plasma membrane; Neurotrophic factor-mediated Trk receptor signaling; Signal Transduction; Signalling by NGF; Signalling to ERKs; Signalling to p38 via RIT and RIN; Trk receptor signaling mediated by the MAPK pathway
Citations
Publication ()
Have you cited DPABH-13915 in a publication? Let us know and earn a reward for your research.
My Review for Anti-RIT1 (aa 11-60) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
