Synthetic peptide corresponding to a region within internal sequence amino acids 508 - 557 (KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKST I) of Human PTBP1 (NP_002810)
Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA.
Pathway
Gene Expression; Processing of Capped Intron-Containing Pre-mRNA; mRNA Splicing; mRNA Splicing - Major Pathway; mRNA processing;
Citations
Publication ()
Have you cited DPABH-18460 in a publication? Let us know and earn a reward for your research.
My Review for Anti-PTBP1 (aa 508-557) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.