Anti-MAPK14 monoclonal antibody, clone 21C22D9

Antibody Isotype

IgG1

Clone

21C22D9

Species Reactivity

Mouse; Rat; Human; Monkey

Immunogen

Recombinant fragment within Human p38 aa 299-360. The exact sequence is proprietary. Expressed in E. coli.Sequence: AAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISF VPPPLDQEEMES Database link: Q16539

Conjugate

Application Notes

IHC-P: 1/200 - 1/1000; WB: 1/500 - 1/2000.

Alternative Names

MAPK14; mitogen-activated protein kinase 14; CSBP1, CSBP2, CSPB1; Mxi2; p38; p38 MAP kinase; PRKM14; PRKM15; MAP kinase 14; p38alpha Exip; MAP kinase Mxi2; MAP kinase p38 alpha; CSAID-binding protein; Csaids binding protein; MAX-interacting protein 2; str

Entrez Gene ID

UniProt ID

Antigen Description

Responds to activation by environmental stress, pro-inflammatory cytokines and lipopolysaccharide (LPS) by phosphorylating a number of transcription factors, such as ELK1 and ATF2 and several downstream kinases, such as MAPKAPK2 and MAPKAPK5. Plays a critical role in the production of some cytokines, for example IL-6. May play a role in stabilization of EPO mRNA during hypoxic stress. Isoform Mxi2 activation is stimulated by mitogens and oxidative stress and only poorly phosphorylates ELK1 and ATF2. Isoform Exip may play a role in the early onset of apoptosis.

Pathway

ADP signalling through P2Y purinoceptor 1, organism-specific biosystem; ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem;