Anti-INHA (aa 109-158) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Synthetic peptide corresponding to a region within N terminal amino acids 109-158 (LFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALS P) of Human Inhibin alpha (NP_002182)

Conjugate

Application Notes

WB: 1 μg/ml; Peptide ELISA: 1/1562500; ICC/IF: 10 μg/ml;

Alternative Names

INHA; inhibin, alpha; inhibin alpha chain; A-inhibin subunit;

Entrez Gene ID

UniProt ID

Antigen Description

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Pathway

Glycoprotein hormones; Ovarian Infertility Genes; Peptide hormone metabolism;