Rabbit Anti-FSHR Polyclonal antibody (DPABH-15680)

Rabbit Anti-Human FSHR Polyclonal antibody for WB, IHC, IF, FC, ELISA Datasheet

Online Inquiry Add to basket   

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, mature ewes
Immunogen
FSHR fusion protein, sequence: CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINIHTIERNSFVGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSILRQEVDYMTQTRGQRSSLAEDNESSYSRGFDMTYTEFDYDLCNEVVDVTCSPKPDA (18-352aa encoded by BC118548)
Conjugate
unconjugated

Applications


Application Notes
WB: 1:500-1:2000
IF: 1:50-1:500
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
FSHR; follicle stimulating hormone receptor; LGR1; ODG1; FSHRO; follicle-stimulating hormone receptor
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-15680 in a publication? Let us know and earn a reward for your research.

References


Song, RX; Stanton, P; et al. ENGINEERING DESIGN OF DEEPWATER FREE STANDING HYBRID RISER. PROCEEDINGS OF THE ASME 29TH INTERNATIONAL CONFERENCE ON OCEAN, OFFSHORE AND ARCTIC ENGINEERING 2010, VOL 5, PTS A AND B :637-649(2010).
Lindgren, I; Giwercman, A; et al. Association between follicle-stimulating hormone receptor polymorphisms and reproductive parameters in young men from the general population. PHARMACOGENETICS AND GENOMICS 22:667-672(2012).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-FSHR Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket