Rabbit Anti-DNMT1 Polyclonal antibody (DPABH-03750)

Rabbit Anti-Human DNMT1 Polyclonal antibody for WB, IP, IF, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Rat, Chicken, Pig
Immunogen
DNMT1 fusion protein, sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD (1288-1632 aa encoded by BC126227)
Conjugate
unconjugated

Applications


Application Notes
WB: 1:200-1:1000
IP: 0.5-4.0 ug for IP and 1:500-1:1000 for WB
IF: 1:10-1:100
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
DNMT1; DNA (cytosine-5-)-methyltransferase 1; AIM; DNMT; MCMT; CXXC9
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-03750 in a publication? Let us know and earn a reward for your research.

References


Poon, HK; Lee, KH; et al. Absence of paternal accessory sex gland secretions disturbs epigenetic reprogramming and expression of Igf2 and Dlk1 in golden hamster embryos. THERIOGENOLOGY 71:1367-1380(2009).
Thabet, Y; Le Dantec, C; et al. Epigenetic dysregulation in salivary glands from patients with primary Sjogren's syndrome may be ascribed to infiltrating B cells. JOURNAL OF AUTOIMMUNITY 41:175-181(2013).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-DNMT1 Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket