Specifications
Immunogen
Recombinant Protein
(QSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRV)
Applications
Application Notes
ELISA 1:1000-2000, WB 1:1000
Each laboratory should determine an optimum working titer for use in its particular application.
Other applications have not been tested but use in such assays should not necessarily be excluded.
Target
Alternative Names
CSF3; GCSF; CSF3OS; C17orf33; MGC45931; granulocyte colony-stimulating factor; filgrastim; lenograstim; pluripoietin; OTTHUMP00000164325; OTTHUMP00000164326; OTTHUMP00000164327; OTTHUMP00000164328
Product Background
Pathway
Cytokine-cytokine receptor interaction, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Malaria, organism-specific biosystem; Malaria, conserved biosystem; Hematopoietic cell lineage, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody.
Learn More
Citations
Have you cited DMABB-JX224 in a publication?
Let us know and earn a reward for your research.
| Product Name |
Cat. No. |
Applications |
Host Species |
Datasheet |
Price |
Add to Basket |
| Product Name |
Cat. No. |
Applications |
Host Species |
Datasheet |
Price |
Add to Basket |
Zhou, JR; Wu, RQ; et al. A20-binding inhibitor of NF-kappa B (ABIN1) controls Toll-like receptor-mediated CCAAT/enhancer-binding protein beta activation and protects from inflammatory disease. PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 108:E998-E1006(2011).
Kowanetz, M; Wu, XM; et al. Granulocyte-colony stimulating factor promotes lung metastasis through mobilization of Ly6G+Ly6C+ granulocytes. PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 107:21248-21255(2010).
COA
Certificate of Analysis
