Synthetic peptide within Human REPS2 aa 415-464 (C terminal). The exact sequence is proprietary.Sequence: KDVLYSQPPSKPIRRKFRPENQATENQEPSTAASGPASAATMKPHPTVQK Database link: Q8NFH8-2
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
REPS2; RALBP1 associated Eps domain containing 2; ralBP1-associated Eps domain-containing protein 2; POB1; partner of RalBP1; RALBP1-interacting protein 2; partner of Ral-binding protein 1;
REPS2 is part of a protein complex that regulates the endocytosis of growth factor receptors. It directly interacts with a GTPase activating protein that functions downstream of the small G protein Ral. Its expression can negatively affect receptor internalization and inhibit growth factor signaling. Multiple transcript variants encoding different isoforms have been found for this gene.
Pathway
EGFR1 Signaling Pathway;
Citations
Publication ()
Have you cited DPABH-12887 in a publication? Let us know and earn a reward for your research.
My Review for Anti-REPS2 (aa 415-464) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
