40976 (NP_659458, 77 a.a. ~ 153 a.a) partial recombinant protein with GST tag. The sequence is QDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKL KPLRKWEKLQMTSSERR
Conjugate
Unconjugated
Target
Alternative Names
MARCH8; membrane-associated ring finger (C3HC4) 8, E3 ubiquitin protein ligase; MIR; c-MIR; RNF178; MARCH-VIII; E3 ubiquitin-protein ligase MARCH8; RING finger protein 178; membrane-associated RING-CH protein VIII; membrane-associated RING finger protein
MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 [PubMed 12582153]; Bartee et al., 2004 [PubMed 14722266]).[supplied by OMIM, Apr 2010]
Citations
Publication ()
Have you cited DPAB-DC964 in a publication? Let us know and earn a reward for your research.
My Review for Anti-MARCH8 (aa 77-153) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.