Recombinant full length protein corresponding to Human Angiomotin aa 1-675. Isoform 2; also known as p80. produced in HEK293T cell.Sequence: MPRAQPSSASYQPVPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKV ARLQKVETEIQRVSEAYENL VKSSSKREALEKAMRNKLEGEIRRMHDF NRDLRERLETANK
Plays a central role in tight junction maintenance via the complex formed with ARHGAP17, which acts by regulating the uptake of polarity proteins at tight junctions. Appears to regulate endothelial cell migration and tube formation. May also play a role in the assembly of endothelial cell-cell junctions.
Pathway
Signal Transduction, organism-specific biosystem; Signaling by Hippo, organism-specific biosystem.
Citations
Publication ()
Have you cited DCABH-6761 in a publication? Let us know and earn a reward for your research.
My Review for Anti-AMOT monoclonal antibody, clone 2B9
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
