Synthetic peptide located within the following region: NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGATDLPGQEW
Conjugate
Unconjugated
Applications
Application Notes
WB Each laboratory should determine an optimum working titer for use in its particular application. Other applications have not been tested but use in such assays should not necessarily be excluded.
Target
Alternative Names
ZP3; zona pellucida glycoprotein 3 (sperm receptor); zona pellucida glycoprotein 3A (sperm receptor) , ZP3A, ZP3B; zona pellucida sperm-binding protein 3; ZP3 372; ZP3 424; HUMZP3; Sperm receptor; zona pellucida glycoprotein 3 (sperm receptor); zona pellu
My Review for Rabbit Anti-Human ZP3 (aa 323-363) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
