Specifications
Immunogen
A synthetic peptide directed towards the N terminal of human DNASE1. Synthetic peptide located within the following region: GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
Target
Alternative Names
DNASE1; deoxyribonuclease I; DNL1; DRNI; deoxyribonuclease-1; Dornase alfa; DNase I, lysosomal; human urine deoxyribonuclease I;
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody.
Learn More
Citations
Have you cited CABT-ZB047 in a publication?
Let us know and earn a reward for your research.
| Product Name |
Cat. No. |
Applications |
Host Species |
Datasheet |
Price |
Add to Basket |
| Product Name |
Cat. No. |
Applications |
Host Species |
Datasheet |
Price |
Add to Basket |
Karmakar, P; Natarajan, AT; et al. Characteristics of UV-induced repair patches relative to the nuclear skeleton in human fibroblasts. MUTAGENESIS 15:115-120(2000).
Leffler, J; Martin, M; et al. Neutrophil Extracellular Traps That Are Not Degraded in Systemic Lupus Erythematosus Activate Complement Exacerbating the Disease. JOURNAL OF IMMUNOLOGY 188:3522-3531(2012).
COA
Certificate of Analysis
