A synthetic peptide directed towards the N terminal of human DNASE1. Synthetic peptide located within the following region: GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD
Conjugate
Unconjugated
Target
Alternative Names
DNASE1; deoxyribonuclease I; DNL1; DRNI; deoxyribonuclease-1; Dornase alfa; DNase I, lysosomal; human urine deoxyribonuclease I;
My Review for Rabbit Anti-Human DNASE1 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
