ZNRF2 (NP_667339, 146 a.a. ~ 207 a.a) partial recombinant protein with GST tag. The sequence is LPAHLSPHMFGGFKCPVCSKFVSSDEMDLHLVMCLTKPRITYNEDVLSKDAGECAICLEE LQ
Conjugate
Unconjugated
Target
Alternative Names
ZNRF2; zinc and ring finger 2; RNF202; E3 ubiquitin-protein ligase ZNRF2; protein Ells2; RING finger protein 202; zinc finger/RING finger 2; zinc/RING finger protein 2;
ZNRF2 (zinc and ring finger 2) is a protein-coding gene. Diseases associated with ZNRF2 include neuronitis. GO annotations related to this gene include zinc ion binding and ligase activity. An important paralog of this gene is ZNRF1.
Citations
Publication ()
Have you cited DPAB-DC976 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ZNRF2 (aa 146-207) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
