Anti-UBQLN2 (aa 555-624) polyclonal antibody

Species Reactivity

Human

Immunogen

UBQLN2 (NP_038472, 555 a.a. ~ 624 a.a) partial recombinant protein with GST tag. The sequence is PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAA IERLLGSQPS

Conjugate

Alternative Names

UBQLN2; ubiquilin 2; DSK2; ALS15; CHAP1; N4BP4; PLIC2; HRIHFB2157; ubiquilin-2; Nedd4 binding protein 4; ubiquitin-like product Chap1/Dsk2; protein linking IAP with cytoskeleton 2;

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases; and thus, are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein.

Pathway

Protein processing in endoplasmic reticulum;