Synthetic peptide corresponding to a region within the internal amino acids 1080-1129 (IKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST I) of Human Tankyrase (NP_003738).
May regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. Has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length.
Pathway
Regulation of Telomerase; Signaling by Wnt; degradation of AXIN;
Citations
Publication ()
Have you cited DPABH-18750 in a publication? Let us know and earn a reward for your research.
My Review for Anti-TNKS (aa 1080-1129) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
