TNFAIP1 (NP_066960, 258 a.a. ~ 316 a.a) partial recombinant protein with GST tag. The sequence is TPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD
Conjugate
Unconjugated
Target
Alternative Names
TNFAIP1; tumor necrosis factor, alpha-induced protein 1 (endothelial); B12; B61; EDP1; BTBD34; hBACURD2; BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2; BTB/POZ domain-containing protein TNFAIP1;
This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. Studies of a similar gene in mouse suggest that the expression of this gene is developmentally regulated in a tissue-specific manner.
Citations
Publication ()
Have you cited DPAB-DC3082 in a publication? Let us know and earn a reward for your research.
My Review for Anti-TNFAIP1 (aa 258-316) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
