Kua-UEV (NP_954673, 94 a.a. ~ 164 a.a) partial recombinant protein with GST tag. The sequence is VHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLNMAYK FRTHSPEALEQ
The TMEM189-UEV mRNA is an infrequent but naturally occurring read-through transcript of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this read-through mRNA and the function of its protein product has not yet been determined.
Pathway
Activated TLR4 signalling; Antigen processing: Ubiquitination & Class I MHC mediated antigen processing & Cytokine Signaling in Immune system
Citations
Publication ()
Have you cited DPAB-DC1807 in a publication? Let us know and earn a reward for your research.
My Review for Anti-TMEM189-UBE2V1 (aa 94-164) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
