Synthetic peptide within Human C1orf49 aa 29-78 (internal sequence). The exact sequence is proprietary.Sequence: LINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRPKKMDGASGVNGAPC Database link: Q5T0J7-4
This gene product is a member of the FAM186 family, however, its exact function is not known. Alternatively spliced transcript variants have been found for this gene.
Citations
Publication ()
Have you cited DPABH-12907 in a publication? Let us know and earn a reward for your research.
My Review for Anti-TEX35 (aa 29-78) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
