Anti-TAF6L polyclonal antibody (DPABH-13075)


Host Species
Antibody Isotype
Species Reactivity
Synthetic peptide within Human TAF6L aa 570-619 (C terminal). The exact sequence is proprietary. NP_006464Sequence: GRRCRGRLFQTAFPAPYGPSPASRYVQKLPMIGRTSRPARRWALSDYSLY Database link: Q9Y6J9 Run BLAST with Run BLAST with


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.


Alternative Names
TAF6L; TAF6-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa; TAF6 like RNA polymerase II, p300/CBP associated factor (PCAF) associated factor, 65 kD; TAF6-like RNA polymerase II p300/CBP-associated factor-associated fact
Entrez Gene ID
UniProt ID

Product Background

Basal transcription factors; Herpes simplex infection;


Have you cited DPABH-13075 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling

We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews

Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket


Weake, VM; Swanson, SK; et al. A novel histone fold domain-containing protein that replaces TAF6 in Drosophila SAGA is required for SAGA-dependent gene expression. GENES & DEVELOPMENT 23:2818-2823(2009).

Online Inquiry

Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket