Synthetic peptide within Human SPATA20 aa 378-427 (C terminal). The exact sequence is proprietary.Sequence: GFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGATEPLTSGQ Database link: Q8TB22-4
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
SPATA20; spermatogenesis associated 20; SSP411; Tisp78; spermatogenesis-associated protein 20; sperm protein SSP411; sperm-specific protein 411; transcript increased in spermiogenesis 78;
My Review for Anti-SPATA20 (aa 378-427) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
