Synthetic peptide within Human SFTPA1 aa 180-229 (C terminal). The exact sequence is proprietary.Sequence: KYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYT Database link: Q8IWL2
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
SFTPA1; surfactant protein A1; SFTP1, surfactant, pulmonary associated protein A1; pulmonary surfactant-associated protein A1; COLEC4; SP A; SP A1; surfactant; pulmonary associated protein A1A; collectin-4; surfactant protein A1B; alveolar proteinosis pro
In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration.
My Review for Anti-SFTPA1 (aa 180-229) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.