Synthetic peptide corresponding to a region within internal amino acids 203-252 (GMKIGVPWSCRYLSSHPCICFISIDNKKRNIESSECGPSVVIQTTVPFG V) of Mouse Renalase (NP_001161290).
Probable FAD-dependent amine oxidase secreted by the kidney, which circulates in blood and modulates cardiac function and systemic blood pressure. Degrades catecholamines such as dopamine, norepinephrine and epinephrine in vitro. Lowers blood pressure in vivo by decreasing cardiac contractility and heart rate and preventing a compensatory increase in peripheral vascular tone, suggesting a causal link to the increased plasma catecholamine and heightened cardiovascular risk. High concentrations of catecholamines activate plasma renalase and promotes its secretion and synthesis (By similarity). According to PubMed:17385068, is unlikely that renalase has physiologically relevant catecholamine-oxidizing activity.
Citations
Publication ()
Have you cited DPABH-28423 in a publication? Let us know and earn a reward for your research.
My Review for Anti-RNLS (aa 203-252) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
