Synthetic peptide within Human RNF150 aa 184-233 (C terminal). The exact sequence is proprietary.Sequence: ALGIPPNADCMDDLPTDFEGSLGGPPTNQITGASDTTVNESSVTLDPAVR Database link: Q9ULK6-4
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
RNF150; ring finger protein 150; RING finger protein 150; KIAA1214; MGC125502;
RNF150 contains a RING-type zinc finger, a motif known to be involved in protein-protein and protein-DNA interactions. The specific function of this protein is unknown.
Citations
Publication ()
Have you cited DPABH-13120 in a publication? Let us know and earn a reward for your research.
My Review for Anti-RNF150 (aa 184-233) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.