Synthetic peptide corresponding to a region within N terminal amino acids 287-336 (ALKDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQP K) of Human RHBDF1 (NP_071895).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml; Peptide ELISA: 1/62500;
Target
Alternative Names
RHBDF1; rhomboid 5 homolog 1 (Drosophila); Dist1; hDist1; C16orf8; EGFR-RS; gene-89; gene-90; inactive rhomboid protein 1; iRhom1; p100hRho; rhomboid family 1; rhomboid family member 1; epidermal growth factor receptor-related protein; epidermal growth fa
RHBDF1 is a seven-transmembrane protein with a long N-terminal cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth signals in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.
Citations
Publication ()
Have you cited DPABH-18149 in a publication? Let us know and earn a reward for your research.
My Review for Anti-RHBDF1 (aa 287-336) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
