Synthetic peptide within Human PTPN22 aa 361-410 (internal sequence). The exact sequence is proprietary.Sequence: TAPRIDDEIPPPLPVWTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSL
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
PTPN22; protein tyrosine phosphatase, non-receptor type 22 (lymphoid); protein tyrosine phosphatase, non receptor type 8; PTPN8; tyrosine-protein phosphatase non-receptor type 22; Lyp; Lyp1; Lyp2; lymphoid phosphatase; PEST-domain phosphatase; lymphoid-sp
Seems to act on Cbl. May play a role in regulating the function of Cbl and its associated protein kinases. Acts as negative regulator of T cell receptor (TCR) signaling. Dephosphorylates and inactivates the SRC family kinases.
Pathway
T Cell Receptor Signaling Pathway;
Citations
Publication ()
Have you cited DPABH-13879 in a publication? Let us know and earn a reward for your research.
My Review for Anti-PTPN22 (aa 361-410) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.