Specifications
Immunogen
Recombinant fragment corresponding to Human NAP2 aa 45-112.Sequence: LAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEV IATLKDGRKI CLDPDAPR Database link: P02775
Applications
Application Notes
IHC-P: 1/100 - 1/500; WB: 1/1000 - 1/2000;
Target
Alternative Names
PPBP; pro-platelet basic protein (chemokine (C-X-C motif) ligand 7); PBP; TC1; TC2; TGB; LDGF; MDGF; TGB1; B-TG1; CTAP3; CXCL7; NAP-2; SCYB7; THBGB; LA-PF4; THBGB1; Beta-TG; CTAPIII; CTAP-III; platelet basic protein; thrombocidin 1; thrombocidin 2; beta-t
Product Background
Antigen Description
LA-PF4 stimulates DNA synthesis, mitosis, glycolysis, intracellular cAMP accumulation, prostaglandin E2 secretion, and synthesis of hyaluronic acid and sulfated glycosaminoglycan. It also stimulates the formation and secretion of plasminogen activator by human synovial cells. NAP-2 is a ligand for CXCR1 and CXCR2, and NAP-2, NAP-2(73), NAP-2(74), NAP-2(1-66), and most potent NAP-2(1-63) are chemoattractants and activators for neutrophils. TC-1 and TC-2 are antibacterial proteins, in vitro released from activated platelet alpha-granules. CTAP-III(1-81) is more potent than CTAP-III desensitize chemokine-induced neutrophil activation.
Pathway
Chemokine receptors bind chemokines; Chemokine signaling pathway; Cytokine-cytokine receptor interaction; G alpha (i) signalling events
Citations
Publication ()
Have you cited DPABH-08346 in a publication?
Let us know and earn a reward for your research.
COA
Loading ......
