Synthetic peptide within Human OR10R2 aa 229-278 (C terminal). The exact sequence is proprietary. (NP_001004472).Sequence: VPFLFICVSYLCILRTILKIPSAEGRRKAFSTCASHLSVVIVHYGCASFI Database link: Q8NGX6
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
OR10R2; olfactory receptor, family 10, subfamily R, member 2; OR1-8; OR10R2Q; olfactory receptor 10R2; olfactory receptor OR1-8;
My Review for Anti-OR10R2 (aa 229-278) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
