Anti-NR2C1 monoclonal antibody (DCABH-6863)

Specifications


Host Species
Mouse
Antibody Isotype
IgG2a
Clone
5F5
Species Reactivity
Human
Immunogen
Recombinant fragment corresponding to Human TR2-11 aa 1-237. NP_001027458 produced in E.coli.Sequence: MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHD GSTPSKVILARQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDN SPDQGPNKVFDLCVVCGDKASGRHYGAVTCEGCKGFFKRSIRKNLVYSCR
Conjugate
Unconjugated

Applications


Application Notes
WB: 1/2000;
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
NR2C1; nuclear receptor subfamily 2, group C, member 1; TR2; nuclear receptor subfamily 2 group C member 1; TR2 11; orphan nuclear receptor TR2
Entrez Gene ID
UniProt ID

Product Background


Pathway
Gene Expression, organism-specific biosystem; Generic Transcription Pathway, organism-specific biosystem; Nuclear Receptor transcription pathway, organism-specific biosystem; Regulation of Androgen receptor activity, organism-specific biosystem; Signaling events mediated by HDAC Class I, organism-specific biosystem;

Citations


Have you cited DCABH-6863 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Bracci, PM; Zhou, M; et al. Serum autoantibodies to pancreatic cancer antigens as biomarkers of pancreatic cancer in a San Francisco Bay Area case-control study. CANCER 118:5384-5394(2012).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket