NME2 (NP_002503, 51 a.a. ~ 152 a.a) partial recombinant protein with GST tag. The sequence is HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCI QVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of A (encoded by NME1) and B (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product.
My Review for Anti-NME2 (aa 51-152) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
References
Synthesis of a novel functionalized tricyclic pyrimidine-fused 1,5-benzodiazepine library
A series of novel tricyclic pyrimidine-fused 1,5-benzodiazepines (PFBZDs) was synthesized using an enaminone-based approach. The key step in the synthetic strategy involves the formation of the C=C-NMe2 structure on vicinal carbonyl groups of the 1H-1,5-benzodiazepine-2,4(3H,5H)-dione (BZD). The synthesis of pyrimidine-fused 1,5-benzodiazepines was performed by a simple and efficient method in good to excellent yields under mild and green conditions. The beta-enaminoamide intermediates were condensed with thiourea and guanidine derivatives to form the corresponding tricyclic PFBZDs. But reaction of aminoguanidine, thiosemicarbazide, 4-phenylthiosemicarbazide and ethane-1,2-diamine with (beta-enaminoamides didn't produce any desired product and led to recovery of the corresponding starting BZD. (C) 2017 Elsevier Ltd. All rights reserved.
C-F bond arylation of fluoroarenes catalyzed by Pd-0 phosphine complexes: theoretical insight into regioselectivity, reactivity, and prediction of ligands
Palladium-catalyzed C-F bond arylation of pentafluorobenzene was theoretically investigated as an example of aryl-F bond functionalization. DFT computations show that C3-regioselective arylation of pentafluorobenzene occurs more favorably than C1 and C2-ones as reported experimentally, through oxidative addition of the C-F bond to Pd-0 species, transmetalation and reductive elimination of the C-C bond. Oxidative addition of the C-F bond is the rate-determining and regioselectivity-determining step. The lower energy transition state of the oxidative addition of the C3-F bond (TS-C3) arises from a larger stabilization energy between Pd-0(BrettPhos) and distorted pentafluorobenzene moieties in TS-C3 than those in TS-C1 and TS-C2. The larger stabilization energy is a result of a lower sigma* orbital energy of the distorted C3-F bond than those of C1-F and C2-F bonds, which leads to a larger charge transfer from the Pd d pi orbital to the sigma* orbital of the C3-F bond. The results suggest that both sigma* orbital energy and bond dissociation energy are important factors for determining the reactivity of the C-F bond. Also, the activation barriers of the C-F bond with different substitution groups follow the order: NO2 < COOMe < CN similar to CF3 < F, which is approximately consistent with the order of electron-withdrawing ability of these groups. It is theoretically predicted here that NMe2-substituted BrettPhos is better for C-F bond cleavage than BrettPhos, where three NMe2 groups are introduced to BrettPhos instead of the isopropyl groups.
COA
Publication 
Loading ......
