Synthetic peptide within Human NLRC5 aa 89-138 (N terminal). The exact sequence is proprietary.Sequence: LLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKK Database link: Q86WI3-5
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
NLRC5; NLR family, CARD domain containing 5; protein NLRC5; CLR16.1; FLJ21709; NOD like receptor C5; NOD27; nucleotide binding oligomerization domain; leucine rich repeat and CARD domain containing 5; NOD-like receptor C5; caterpiller protein 16.1; nucleo
Probable regulator of the NF-kappa-B and type I interferon signaling pathways. May also regulate the type II interferon signaling pathway. Plays a role in homeostatic control of innate immunity and in antiviral defense mechanisms.
Pathway
Immune System; Innate Immune System; Negative regulators of RIG-I/MDA5 signaling; RIG-I/MDA5 mediated induction of IFN-alpha/beta pathways;
Citations
Publication ()
Have you cited DPABH-12873 in a publication? Let us know and earn a reward for your research.
My Review for Anti-NLRC5 (aa 89-138) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
