Synthetic peptide within Human MYLK4 aa 336-385 (C terminal). The exact sequence is proprietary. (NP_001012418)Sequence: EFISKLLIKEKSWRISASEALKHPWLSDHKLHSRLNAQKKKNRGSDAQDF Database link: Q86YV6
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
MYLK4; myosin light chain kinase family, member 4; myosin light chain kinase family member 4; caMLCK like; SgK085; sugen kinase 85;
MYLK4 (myosin light chain kinase family, member 4) is a protein-coding gene. Diseases associated with MYLK4 include endotheliitis, and alcoholism, and among its related super-pathways are Focal Adhesion and Regulation of Actin Cytoskeleton. GO annotations related to this gene include protein serine/threonine kinase activity and ATP binding. An important paralog of this gene is STK17B.
Citations
Publication ()
Have you cited DPABH-13006 in a publication? Let us know and earn a reward for your research.
My Review for Anti-MYLK4 (aa 336-385) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
