Synthetic peptide within Human MTAP aa 2-51 (N terminal). The exact sequence is proprietary. Isoform 2Sequence: ASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIK Database link: Q13126-2
Plays a major role in polyamine metabolism and is important for the salvage of both adenine and methionine.
Pathway
Cysteine and methionine metabolism; Metabolic pathways; Metabolism; Metabolism of amino acids and derivatives; Metabolism of polyamines; Methionine salvage pathway;
Citations
Publication ()
Have you cited DPABH-13148 in a publication? Let us know and earn a reward for your research.
My Review for Anti-MTAP (aa 2-51) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
