Anti-MST4 (aa 331-415) polyclonal antibody

Species Reactivity

Human

Immunogen

RP6-213H19.1 (NP_057626, 331 a.a. ~ 415 a.a) partial recombinant protein with GST tag. The sequence is KKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEA ACPGITDKMVKKLIEKFQKCSADES

Conjugate

Alternative Names

MST4; MASK; serine/threonine-protein kinase MST4; STE20-like kinase MST4; mammalian sterile 20-like 4; Mst3 and SOK1-related kinase; serine/threonine-protein kinase MASK; mammalian Ste20-like protein kinase 4;

Entrez Gene ID

UniProt ID

Antigen Description

The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Pathway

Apoptosis; Apoptotic execution phase;