Synthetic peptide within Human LRRFIP1 aa 758-808 (C terminal). The exact sequence is proprietary. (NP_001131024.1).Sequence: QTVRKALDSNSLENDDLSAPGREPGHFNPESREDTRGGNEKGKSKEDCTM S Database link: Q32MZ4
Conjugate
Unconjugated
Applications
Application Notes
WB: 1/2000 - 1/10000; IP: 2-5 μg/mg lysate.
Target
Alternative Names
LRRFIP1; leucine rich repeat (in FLII) interacting protein 1; leucine-rich repeat flightless-interacting protein 1; FLAP 1; FLIIAP1; GC binding factor 2; GCF 2; HUFI 1; TRIP; GC-binding factor 2; NEDD8-conjugating enzyme; TAR RNA-interacting protein; LRR
Transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5-AGCCCCCGGCG-3) and may regulate expression of TNF, EGFR and PDGFA. May control smooth muscle cells proliferation following artery injury through PDGFA repression. May also bind double-stranded RNA.
Citations
Publication ()
Have you cited DPABH-12012 in a publication? Let us know and earn a reward for your research.
My Review for Anti-LRRFIP1 (aa 758-808) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
