Synthetic peptide corresponding to a region within the N terminal amino acids 36-85 (STTPLSHVPSAAAQGAWSWEWYLKEQKAVAAPVELFSKDQSFPEHENGF Q) of Human L3MBTL4, NP_775735.
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
L3MBTL4; l(3)mbt-like 4 (Drosophila); lethal(3)malignant brain tumor-like protein 4; FLJ35936; HsT1031; l(3)mbt-like protein 4; H-l(3)mbt-like protein 4;
L3MBTL4 contains 3 MBT repeats and 1 SAM (sterile alpha motif) domain. The exact function of L3MBTL4 remains unknown.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-18670 in a publication? Let us know and earn a reward for your research.
Knight, MJ; Leettola, C; et al. A human sterile alpha motif domain polymerizome. PROTEIN SCIENCE 20:1697-1706(2011).
Veigaard, C; Norgaard, JM; et al. Genomic profiling in high hyperdiploid acute myeloid leukemia: a retrospective study of 19 cases. CANCER GENETICS 204:516-521(2011).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-L3MBTL4 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis