Recombinant fragment corresponding to Human KCTD16 aa 324-390.Sequence: PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGS RESNMSSKKKAVKEKLS Database link: Q68DU8
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/50 - 1/200.
Target
Alternative Names
KCTD16; potassium channel tetramerisation domain containing 16; BTB/POZ domain-containing protein KCTD16; KIAA1317; potassium channel tetramerization domain-containing protein 16; MGC138167; DKFZp781A1155;
Auxiliary subunit of GABA-B receptors that determine the pharmacology and kinetics of the receptor response. Increases agonist potency and markedly alter the G-protein signaling of the receptors by accelerating onset and promoting desensitization.
Citations
Publication ()
Have you cited DPABH-14735 in a publication? Let us know and earn a reward for your research.
My Review for Anti-KCTD16 (aa 324-390) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
