Anti-SLC22A18 (aa 108-157) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Synthetic peptide, corresponding to a region within N terminal amino acids 108-157 (AASSPALPGVYLLFASRLPGALMHTLPAAQMVITDLSAP EERPAALGRLG) of Human Solute carrier family 22 member 18

Conjugate

Application Notes

WB: 1 μg/ml; ELISA: 1/312500.

Alternative Names

SLC22A18; solute carrier family 22, member 18; BWSCR1A, IMPT1, ORCTL2, SLC22A1L,solute carrier family 22 (organic cation transporter), member 1 like; solute carrier family 22 member 18; BWR1A; ITM; TSSC5; IMPT1; OTTMUSP00000030800; Beckwith Wiedemann synd

Entrez Gene ID

UniProt ID

Antigen Description

This gene is one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. This gene is imprinted, with preferential expression from the maternal allele. Mutations in this gene have been found in Wilms tumor and lung cancer. This protein may act as a transporter of organic cations, and have a role in the transport of chloroquine and quinidine-related compounds in kidney. Two alternatively spliced transcript variants encoding the same protein have been described.

Pathway

Organic cation transport, organism-specific biosystem; Organic cation/anion/zwitterion transport, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds, organism-specific biosystem;