Anti-GSR polyclonal antibody (DPAB-DC1486)

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
GSR (NP_000628, 413 a.a. ~ 522 a.a) partial recombinant protein with GST tag. The sequence is TVVFSHPPIGTVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Conjugate
Unconjugated

Target


Alternative Names
GSR; glutathione reductase; HEL-75; glutathione reductase, mitochondrial; GR; GRase
Entrez Gene ID
UniProt ID

Product Background


Pathway
Cellular responses to stress; Glutathione metabolism; Metabolism of nucleotides; Selenium Pathway

Citations


Have you cited DPAB-DC1486 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Chung, KF; et al. How can we resolve cortico-resistant and cortico-dependent asthma?. REVUE FRANCAISE D ALLERGOLOGIE ET D IMMUNOLOGIE CLINIQUE 45:17-24(2005).
Ichihara, A; Kaneshiro, Y; et al. Contribution of nonproteolytically activated prorenin in glomeruli to hypertensive renal damage. JOURNAL OF THE AMERICAN SOCIETY OF NEPHROLOGY 17:2495-2503(2006).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket