Synthetic peptide within Human SLD5 aa 173-223. The exact sequence is proprietary. NP_115712.1Sequence: LRVRERQENILVEPDTDEQRDYVIDLEKGSQHLIRYKTIAPLVASGAVQL I Database link: Q9BRT9
Conjugate
Unconjugated
Applications
Application Notes
WB: 1/500 - 1/2500.
Target
Alternative Names
GINS4; GINS complex subunit 4 (Sld5 homolog); SLD5; DNA replication complex GINS protein SLD5; SLD5 homolog;
The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS4 is important for GINS complex assembly. GINS complex seems to bind preferentially to single-stranded DNA.
Pathway
Cell Cycle; DNA Replication; GINS complex; S Phase
Citations
Publication ()
Have you cited DPABH-13473 in a publication? Let us know and earn a reward for your research.
My Review for Anti-GINS4 (aa 173-223) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
