Synthetic peptide within Human RAD26L aa 132-181 (N terminal). The exact sequence is proprietary. Isoform 2.Sequence: ELWCVMDWAVPGLLGSGTYFKKQFSDPVEHGQRHTATKRELATGRKAMQR Database link: Q5T890-2
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
ERCC6L2; excision repair cross-complementation group 6-like 2; BMFS2; SR278; RAD26L; C9orf102; DNA excision repair protein ERCC-6-like 2; stretch responsive protein 278; DNA repair and recombination protein RAD26-like; putative repair and recombination he
Human patatin-like phospholipases, such as PNPLA7, have been implicated in regulation of adipocyte differentiation and have been induced by metabolic stimuli (Wilson et al., 2006 [PubMed 16799181]).[supplied by OMIM, Jun 2008]
Citations
Publication ()
Have you cited DPABH-13885 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ERCC6L2 (aa 132-181) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
