Anti-ERCC1 Antibody (DPATB-H81435)

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Immunogen
Synthetic peptide: SLPQPTRKKFVIPLEDEAPPAGAKPLFRSSRNPSTTAPSV PAAPQTYAEYAIAQPPGGAGPTGPTGSEPVKGENPGQTVK TGAKSNSILVSPRQRGNPVL, corresponding to amino acids 9/108 of Chinese Hamster ERCC1 SLPQPTRKKFVIPLEDEAPPAGAKPLFRSSRNPSTTAPSV PAAPQTYAEYAIAQPPGGAGPTGPTGSEPVK
Conjugate
Unconjugated

Target


Alternative Names
UV20; COFS4; RAD10
Entrez Gene ID
UniProt ID

Citations


Have you cited DPATB-H81435 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Panov, KI; Panova, TB; et al. RNA polymerase I-specific subunit CAST/hPAF49 has a role in the activation of transcription by upstream binding factor. MOLECULAR AND CELLULAR BIOLOGY 26:5436-5448(2006).
Ma, DH; Baruch, D; et al. Using protein microarray technology to screen anti-ERCC1 monoclonal antibodies for specificity and applications in pathology. BMC BIOTECHNOLOGY 12:-(2012).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket