ELAVL4 (NP_068771, 312 a.a. ~ 380 a.a) partial recombinant protein with GST tag. The sequence is VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVS FKTNKAHKS
Conjugate
Unconjugated
Target
Alternative Names
ELAVL4; ELAV like neuron-specific RNA binding protein 4; HUD; PNEM; ELAV-like protein 4; Hu antigen D; paraneoplastic encephalomyelitis antigen HuD; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D);
ELAVL4 (ELAV like neuron-specific RNA binding protein 4) is a protein-coding gene. Diseases associated with ELAVL4 include encephalomyelitis, and sensory peripheral neuropathy. GO annotations related to this gene include mRNA 3'-UTR binding and RNA binding. An important paralog of this gene is PABPC1L.
Citations
Publication ()
Have you cited DPAB-DC844 in a publication? Let us know and earn a reward for your research.
My Review for Anti-ELAVL4 (aa 312-380) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.