EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. The sequence is VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITS AFK
This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants.
Pathway
Calcium signaling pathway; Class A/1 (Rhodopsin-like receptors); Endothelin; G alpha (q) signalling events
Citations
Publication ()
Have you cited DPAB-DC810 in a publication? Let us know and earn a reward for your research.
My Review for Anti-EDNRA (aa 18-80) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
