Synthetic peptide within Human Dnmt3a aa 807-856 (C terminal). The exact sequence is proprietary.Sequence: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE Database link: Q6PJ37
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
DNMT3A; DNA (cytosine-5-)-methyltransferase 3 alpha; DNA (cytosine-5)-methyltransferase 3A; DNA MTase HsaIIIA; DNA cytosine methyltransferase 3A2; DNMT3A2; M.HsaIIIA;
Required for genome wide de novo methylation and is essential for the establishment of DNA methylation patterns during development. DNA methylation is coordinated with methylation of histones. It modifies DNA in a non-processive manner and also methylates non-CpG sites. May preferentially methylate DNA linker between 2 nucleosomal cores and is inhibited by histone H1. Plays a role in paternal and maternal imprinting. Required for methylation of most imprinted loci in germ cells. Acts as a transcriptional corepressor for ZNF238. Can actively repress transcription through the recruitment of HDAC activity.
Pathway
Cysteine and methionine metabolism; Metabolic pathways; Methionine degradation; One Carbon Metabolism; Validated targets of C-MYC transcriptional repression;
Citations
Publication ()
Have you cited DPABH-12575 in a publication? Let us know and earn a reward for your research.
My Review for Anti-DNMT3A (aa 807-856) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
