Synthetic peptide within Human DCK aa 210-260. The exact sequence is proprietary. (NP_000779.1).Sequence: YKHESWLLHRTLKTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST L Database link: P27707
Required for the phosphorylation of the deoxyribonucleosides deoxycytidine (dC), deoxyguanosine (dG) and deoxyadenosine (dA). Has broad substrate specificity, and does not display selectivity based on the chirality of the substrate. It is also an essential enzyme for the phosphorylation of numerous nucleoside analogs widely employed as antiviral and chemotherapeutic agents.
Pathway
Metabolic pathways; Metabolism; Metabolism of nucleotides; Purine metabolism; Purine salvage;
Citations
Publication ()
Have you cited DPABH-15076 in a publication? Let us know and earn a reward for your research.
My Review for Anti-DCK (aa 210-260) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
