Synthetic peptide within Human DBF4B aa 1-50 (N terminal). The exact sequence is proprietary. (NP_079380.2)Sequence: MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSG Database link: Q8NFT6-2 Run BLAST with Run BLAST with
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
DBF4B; DBF4 homolog B (S. cerevisiae); protein DBF4 homolog B; ASKL1; chifb; chiffon homolog B (Drosophila); DRF1; FLJ13087; ZDBF1B; zinc finger; DBF type containing 1B; chiffon homolog B; ASK-like protein 1; Dbf4-related factor 1; zinc finger, DBF-type c
Regulatory subunit for CDC7 which activates its kinase activity thereby playing a central role in DNA replication and cell proliferation. Required for progression of S and M phases. The complex CDC7-DBF4B selectively phosphorylates MCM2 subunit at Ser-40 and then is involved in regulating the initiation of DNA replication during cell cycle.
Citations
Publication ()
Have you cited DPABH-12596 in a publication? Let us know and earn a reward for your research.
My Review for Anti-DBF4B (aa 1-50) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
