Rabbit Anti-CRYAB Polyclonal antibody (DPABH-00332)

Rabbit Anti-Human CRYAB Polyclonal antibody for WB, IP, IHC, IF, ELISA Datasheet

Online Inquiry Add to basket   

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, Rat
Immunogen
Alpha B Crystallin fusion protein, sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK (1-175 aa encoded by BC007008)
Conjugate
unconjugated

Applications


Application Notes
WB: 1:500-1:1000
IP: 0.5-4.0 ug for IP and 1:500-1:1000 for WB
IHC: 1:20-1:200
IF: 1:50-1:500
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
CRYAB; crystallin, alpha B; MFM2; CRYA2; CTPP2; HSPB5
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-00332 in a publication? Let us know and earn a reward for your research.

References


Volkmann, J; Reuning, U; et al. High expression of crystallin B represents an independent molecular marker for unfavourable ovarian cancer patient outcome and impairs TRAIL- and cisplatin-induced apoptosis in human ovarian cancer cells. INTERNATIONAL JOURNAL OF CANCER 132:2820-2832(2013).
Del Bigio, MR; Chudley, AE; et al. Infantile Muscular Dystrophy in Canadian Aboriginals Is an alpha B-Crystallinopathy. ANNALS OF NEUROLOGY 69:866-871(2011).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-CRYAB Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket