Rabbit Anti-CRYAB Polyclonal antibody (DPABH-00332)

Rabbit Anti-Human CRYAB Polyclonal antibody for WB, IP, IHC, IF, ELISA Datasheet

Bring this labeled antibody directly to your bench!

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, Rat
Immunogen
Alpha B Crystallin fusion protein, sequence: MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK (1-175 aa encoded by BC007008)
Conjugate
unconjugated

Applications


Application Notes
WB: 1:500-1:1000
IP: 0.5-4.0 ug for IP and 1:500-1:1000 for WB
IHC: 1:20-1:200
IF: 1:50-1:500
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
CRYAB; crystallin, alpha B; MFM2; CRYA2; CTPP2; HSPB5
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-00332 in a publication? Let us know and earn a reward for your research.

References


Ousman, SS; Tomooka, BH; et al. Protective and therapeutic role for alpha B-crystallin in autoimmune demyelination. NATURE 448:474-U7(2007).
Sanbe, A; Yamauchi, J; et al. Interruption of CryAB-Amyloid oligomer formation by HSP22. JOURNAL OF BIOLOGICAL CHEMISTRY 282:555-563(2007).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-CRYAB Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket