LASS6 (NP_982288, 62 a.a. ~ 131 a.a) partial recombinant protein with GST tag. The sequence is PCAIALNIQANGPQIAPPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRR NQEKPSTLTR
CERS6 (ceramide synthase 6) is a protein-coding gene. Diseases associated with CERS6 include encephalomyelitis, and rheumatoid arthritis, and among its related super-pathways are Sphingolipid metabolism and Metabolic pathways. GO annotations related to this gene include sphingosine N-acyltransferase activity and sequence-specific DNA binding transcription factor activity. An important paralog of this gene is CERS2.
My Review for Mouse anti-Human CERS6 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
